Cart summary

You have no items in your shopping cart.

TM6SF2 Rabbit Polyclonal Antibody (FITC)

TM6SF2 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2119281

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2119281
CategoryAntibodies
DescriptionTM6SF2 Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human TM6SF2
Protein SequenceSynthetic peptide located within the following region: FFTLFRGLVVLDCPTDACFVYIYQYEPYLRDPVAYPKVQMLMYMFYVLPF
UniProt IDQ9BZW4
MW38kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
NoteFor research use only