You have no items in your shopping cart.
TKT Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Mouse, Porcine, Rabbit, Rat, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TKT |
| Target | TKT |
| Protein Sequence | Synthetic peptide located within the following region: ESYHKPDQQKLQALKDTANRLRISSIQATTAAGSGHPTSCCSAAEIMAVL |
| Molecular Weight | 68kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Transketolase/TKT Rabbit Polyclonal Antibody [orb654470]
ELISA, FC, ICC, IF, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μgDDR2 Rabbit Polyclonal Antibody [orb443172]
ELISA, FC, ICC, IF, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The protein may be modified by acetylation and phosphorylation.

TKT antibody - N-terminal region (orb580440), Catalog Number: orb580440, Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue, Observed Staining: Cytoplasm of bronchial epithelial tissue, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

TKT antibody - N-terminal region (orb580440), Catalog Number: orb580440, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Cytoplasm of pneumocytes, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-TKT Antibody Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate. TKT is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
Documents Download
Request a Document
Protocol Information
TKT Rabbit Polyclonal Antibody (orb580440)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review



















