TIAL1 Rabbit Polyclonal Antibody

SKU: orb327616

Description

Rabbit polyclonal antibody to TIAL1

Research Area

Cell Biology, Epigenetics & Chromatin, Molecular Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TIAL1
• Target: TIAL1
• Protein Sequence: Synthetic peptide located within the following region: WNQQGFGVDQSPSAAWMGGFGAQPPQGQAPPPVIPPPNQAGYGMASYQTQ
• Molecular Weight: 42 kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti TCBP antibody, anti TIAR antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Protein may be acetylated or phosphorylated.

Positive control (+): Mouse Spleen (M-SP), Negative control (-): Mouse Liver (M-LI), Antibody concentration: 2 ug/mL.

WB Suggested Anti-TIAL1 Antibody Titration: 1.25 ug/mL, Positive Control: Jurkat cell lysate, TIAL1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.

Quick Database Links

Gene Symbol

TIAL1

UniProt

Q01085

RefSeq (Protein):NP_003243