TIAL1 Rabbit Polyclonal Antibody

• Catalog Number: orb327616
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TIAL1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TIAL1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 42 kDa
• Target: TIAL1
• UniProt ID: Q01085
• Protein Sequence: Synthetic peptide located within the following region: WNQQGFGVDQSPSAAWMGGFGAQPPQGQAPPPVIPPPNQAGYGMASYQTQ
• NCBI: NP_003243
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti TCBP antibody, anti TIAR antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Protein may be acetylated or phosphorylated.

Positive control (+): Mouse Spleen (M-SP), Negative control (-): Mouse Liver (M-LI), Antibody concentration: 2 ug/mL.

WB Suggested Anti-TIAL1 Antibody Titration: 1.25 ug/mL, Positive Control: Jurkat cell lysate, TIAL1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.