Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

THRA Rabbit Polyclonal Antibody

SKU: orb333849

Description

Rabbit polyclonal antibody to THRA

Research Area

Cancer Biology, Cell Biology, Epigenetics & Chromatin, Molecular Biology, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human THRA
TargetTHRA
Protein SequenceSynthetic peptide located within the following region: DQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMAVKREQLKNGGLGVV
Molecular Weight55kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti AR7 antibody, anti c-erbA-1 antibody, anti C-erbA-alpha antibody, anti EAR 7 antibody, anti EAR-7 antibody, anti EAR7 antibody, anti ERB-T-1 antibody, anti ERBA alpha antibody, anti ERBA antibody, anti ERBA Related 7 antibody, anti ERBA-related 7 antibody, anti ERBA1 antibody, anti NR1A1 antibody, anti Nuclear receptor subfamily 1 group A member 1 antibody, anti THRA 1 antibody, anti THRA antibody, anti THRA1 antibody, anti THRA2 antibody, anti Thyroid hormone receptor alpha antibody, anti thyroid hormone receptor, alpha (erythroblastic leukemia viral (v-erb-a) oncogene homolog, avian) antibody, anti thyroid normone nuclear receptor alpha variant 1 antibody, anti triiodothyronine receptor antibody, anti V-erbA-related protein 7 antibody

Similar Products

  • Thyroid hormone receptor alpha Rabbit Polyclonal Antibody [orb100337]

    FC,  WB

    Equine, Gallus, Guinea pig, Porcine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • THRA1+2 Rabbit Polyclonal Antibody [orb100532]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Feline, Gallus, Human, Porcine, Rat, Sheep, Zebrafish

    Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • THRA Antibody [orb684902]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • THRA Rabbit Polyclonal Antibody [orb214669]

    IF,  IHC,  WB

    Canine, Human, Monkey, Mouse, Porcine, Rat

    Rabbit

    Polyclonal

    Unconjugated

    30 μl, 100 μl, 200 μl, 50 μl
  • THRA Rabbit Polyclonal Antibody [orb2952843]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

THRA Rabbit Polyclonal Antibody

Sample Tissue: Mouse Heart, Antibody dilution: 1 ug/ml.

THRA Rabbit Polyclonal Antibody

Sample Tissue: Mouse Spleen, Antibody dilution: 1 ug/ml.

THRA Rabbit Polyclonal Antibody

Positive control (+): Human Ovary (OV), Negative control (-): Human stomach (ST), Antibody concentration: 0.5 ug/ml.

THRA Rabbit Polyclonal Antibody

WB Suggested Anti-THRA Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate, There is BioGPS gene expression data showing that THRA is expressed in Jurkat.

THRA Rabbit Polyclonal Antibody

WB Suggested Anti-THRA antibody Titration: 1 ug/ml, Sample Type: Human heart.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_003241

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

THRA Rabbit Polyclonal Antibody (orb333849)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry