THRA Rabbit Polyclonal Antibody

• Catalog Number: orb333849
• Category: Antibodies
• Description: Rabbit polyclonal antibody to THRA
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human THRA
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 55kDa
• Target: THRA
• UniProt ID: P10827
• Protein Sequence: Synthetic peptide located within the following region: DQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMAVKREQLKNGGLGVV
• NCBI: NP_003241
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti AR7 antibody, anti c-erbA-1 antibody, anti C-
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Heart, Antibody dilution: 1 ug/ml.

Sample Tissue: Mouse Spleen, Antibody dilution: 1 ug/ml.

Positive control (+): Human Ovary (OV), Negative control (-): Human stomach (ST), Antibody concentration: 0.5 ug/ml.

WB Suggested Anti-THRA Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate, There is BioGPS gene expression data showing that THRA is expressed in Jurkat.

WB Suggested Anti-THRA antibody Titration: 1 ug/ml, Sample Type: Human heart.