Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

THRA Rabbit Polyclonal Antibody

SKU: orb333849

Description

THRA Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of THRA. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human THRA. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cancer Biology, Cell Biology, Epigenetics & Chromatin, Molecular Biology, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human THRA
TargetTHRA
Protein SequenceSynthetic peptide located within the following region: DQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMAVKREQLKNGGLGVV
Molecular Weight55kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti AR7 antibody, anti c-erbA-1 antibody, anti C-erbA-alpha antibody, anti EAR 7 antibody, anti EAR-7 antibody, anti EAR7 antibody, anti ERB-T-1 antibody, anti ERBA alpha antibody, anti ERBA antibody, anti ERBA Related 7 antibody, anti ERBA-related 7 antibody, anti ERBA1 antibody, anti NR1A1 antibody, anti Nuclear receptor subfamily 1 group A member 1 antibody, anti THRA 1 antibody, anti THRA antibody, anti THRA1 antibody, anti THRA2 antibody, anti Thyroid hormone receptor alpha antibody, anti thyroid hormone receptor, alpha (erythroblastic leukemia viral (v-erb-a) oncogene homolog, avian) antibody, anti thyroid normone nuclear receptor alpha variant 1 antibody, anti triiodothyronine receptor antibody, anti V-erbA-related protein 7 antibody

Similar Products

  • THRA1+2 Rabbit Polyclonal Antibody [orb100532]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Feline, Gallus, Human, Porcine, Rat, Sheep, Zebrafish

    Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Thyroid hormone receptor alpha Rabbit Polyclonal Antibody [orb100337]

    FC,  WB

    Equine, Gallus, Guinea pig, Porcine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • THRA Antibody [orb684902]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • THRA Rabbit Polyclonal Antibody [orb214669]

    IF,  IHC,  WB

    Canine, Human, Monkey, Mouse, Porcine, Rat

    Rabbit

    Polyclonal

    Unconjugated

    30 μl, 100 μl, 200 μl, 50 μl
  • THRA Antibody (N-Term) [orb1925850]

    WB

    Other, Porcine, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_003241

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry