TH Rabbit Polyclonal Antibody

SKU: orb329585

Description

Rabbit polyclonal antibody to TH

Research Area

Cell Biology, Neuroscience

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the n terminal region of human TH
• Target: TH
• Protein Sequence: Synthetic peptide located within the following region: GAPGPSLTGSPWPGTAAPAASYTPTPRSPRFIGRRQSLIEDARKEREAAV
• Molecular Weight: 58kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti TYH antibody, anti DYT14 antibody, anti DYT5b antibody

Rabbit Anti-TH Antibody, Catalog Number: orb329585, Formalin Fixed Paraffin Embedded Tissue: Human Testis Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.

WB Suggested Anti-TH Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human Small Intestine.

Quick Database Links

Gene Symbol

TH

UniProt

P07101

RefSeq (Protein):NP_954986