TGFBI Rabbit Polyclonal Antibody

• Catalog Number: orb330378
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TGFBI
• Target: TGFBI
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TGFBI
• Protein Sequence: Synthetic peptide located within the following region: LKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPANRPQERGDELADSA
• UniProt ID: Q15582
• MW: 46kDa
• Tested applications: ICC, IF, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti BIGH3 antibody, anti CDB1 antibody, anti CDG2
• Research Area: Epigenetics & Chromatin, Molecular Biology, Signal
• Note: For research use only
• NCBI: AAH26352

Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5 ug/mL, Peptide Concentration: 2.0 ug/mL, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.

Species, Tissue/Cell Type: Human Cornea tissue (epithelium and stroma), Primary used and Dilution: 1:400.

WB Suggested Anti-TGFBI Antibody Titration: 1.25 ug/mL, Positive Control: Jurkat cell lysate.