TFPI2 Rabbit Polyclonal Antibody

• Catalog Number: orb583930
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TFPI2
• Target: TFPI2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TFPI2
• Protein Sequence: Synthetic peptide located within the following region: NANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMT
• UniProt ID: P48307
• MW: 26kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: PP5, REF1, TFPI-2
• Note: For research use only
• NCBI: NP_006519

Sample Type: Human Macrophange Cells, Green: primary, Red: phallodin, Blue: DAPI, Yellow: green/red, Primary dilution: 1:200, Secondary Antibody: anti-Rabbit IgG-FITC, Secondary dilution: 1:1000.

WB Suggested Anti-TFPI2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: MCF7 cell lysate.