TFDP1 Rabbit Polyclonal Antibody

• Catalog Number: orb592893
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TFDP1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IF, IHC, WB
• Predicted Reactivity: Bovine, Mouse
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TFDP1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 45kDa
• Target: TFDP1
• UniProt ID: Q14186
• Protein Sequence: Synthetic peptide located within the following region: VIGTPQRPAASNTLVVGSPHTPSTHFASQNQPSDSSPWSAGKRNRKGEKN
• NCBI: NP_009042
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: DP1, DILC, Dp-1, DRTF1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Human Intestine

Sample Type: HCT116, Primary Antibody Dilution: 4 ug/ml, Secondary Antibody: Anti-rabbit Alexa 546, Secondary Antibody Dilution: 2 ug/ml, Gene Name: TFDP1.

WB Suggested Anti-TFDP1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Liver.