You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329978 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TFAP2C |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TFAP2C |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 49kDa |
Target | TFAP2C |
UniProt ID | Q92754 |
Protein Sequence | Synthetic peptide located within the following region: MLWKITDNVKYEEDCEDRHDGSSNGNPRVPHLSSAGQHLYSPAPPLSHTG |
NCBI | NP_003213 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti AP2-GAMMA antibody, anti ERF1 antibody, anti Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Immunohistochemical staining of human kidney tissue using TFAP2C antibody
Western blot analysis of human Fetal Liver tissue using TFAP2C antibody
Western blot analysis of Transfected 293T tissue using TFAP2C antibody
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, ICC, IF, IHC, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish | |
Canine, Equine, Guinea pig, Human, Mouse, Rat, Sheep, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating