You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb329978 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to TFAP2C |
| Target | TFAP2C |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human, Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TFAP2C |
| Protein Sequence | Synthetic peptide located within the following region: MLWKITDNVKYEEDCEDRHDGSSNGNPRVPHLSSAGQHLYSPAPPLSHTG |
| UniProt ID | Q92754 |
| MW | 49kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti AP2-GAMMA antibody, anti ERF1 antibody, anti Read more... |
| Research Area | Epigenetics & Chromatin, Molecular Biology, Stem C Read more... |
| Note | For research use only |
| NCBI | NP_003213 |

Sample Tissue: Mouse Brain, Antibody Dilution: 1 ug/mL.

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

Human kidney

WB Suggested Anti-TFAP2C Antibody Titration: 1.25 ug/mL, Positive Control: Transfected 293T.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep, Zebrafish | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, FC, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Human, Rabbit | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review