TFAP2C Rabbit Polyclonal Antibody

• Catalog Number: orb329978
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TFAP2C
• Target: TFAP2C
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TFAP2C
• Protein Sequence: Synthetic peptide located within the following region: MLWKITDNVKYEEDCEDRHDGSSNGNPRVPHLSSAGQHLYSPAPPLSHTG
• UniProt ID: Q92754
• MW: 49kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti AP2-GAMMA antibody, anti ERF1 antibody, anti
• Note: For research use only
• NCBI: NP_003213

Sample Tissue: Mouse Brain, Antibody Dilution: 1 ug/mL.

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

Human kidney

WB Suggested Anti-TFAP2C Antibody Titration: 1.25 ug/mL, Positive Control: Transfected 293T.