You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576606 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TFAP2B |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human TFAP2B |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 50kDa |
Target | TFAP2B |
UniProt ID | Q92481 |
Protein Sequence | Synthetic peptide located within the following region: ALTALQNYLTEALKGMDKMFLNNTTTNRHTSGEGPGSKTGDKEEKHRK |
NCBI | NP_003212 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | PDA2, AP-2B, AP2-B, AP-2beta Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/ml.
Sample Tissue: Human HT1080 Whole Cell, Antibody Dilution: 1 ug/ml.
WB Suggested Anti-TFAP2B Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.
ChIP, EMSA, IF, IH, WB | |
Human, Mouse, Porcine, Rat, Sheep | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rat, Zebrafish | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |