Cart summary

You have no items in your shopping cart.

TEX38 Rabbit Polyclonal Antibody (Biotin)

TEX38 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2086978

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2086978
CategoryAntibodies
DescriptionTEX38 Rabbit Polyclonal Antibody (Biotin)
ClonalityPolyclonal
Species/HostRabbit
ConjugationBiotin
Predicted ReactivityHuman
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human TEX38
Protein SequenceSynthetic peptide located within the following region: PDVLWDLDIPEGRSHADQDSNPKAEAPAPLQPALQLAPQQPQARSPFPLP
UniProt IDQ6PEX7
MW23kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesTHEG4, C1orf223, ATPAF1-AS1
NoteFor research use only
NCBINP_001138946