TENT4B Rabbit Polyclonal Antibody

• Catalog Number: orb587994
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TENT4B
• Target: TENT4B
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human PAPD5
• Protein Sequence: Synthetic peptide located within the following region: SSSKGFQGTTQTSHGSLMTNKQHQGKSNNQYYHGKKRKHKRDAPLSDLCR
• UniProt ID: Q8NDF8
• MW: 63 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: TUT3, PAPD5, TRF4-2
• Research Area: Cell Biology, Molecular Biology
• Note: For research use only

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is present at ~43 kDa.

Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/ml.

Rabbit Anti-TENT4B antibody, Formalin Fixed Paraffin Embedded Tissue: Human Liver, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.