Cart summary

You have no items in your shopping cart.

TENT4A Rabbit Polyclonal Antibody (Biotin)

TENT4A Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2114041

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2114041
CategoryAntibodies
DescriptionTENT4A Rabbit Polyclonal Antibody (Biotin)
ClonalityPolyclonal
Species/HostRabbit
ConjugationBiotin
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human POLS
Protein SequenceSynthetic peptide located within the following region: VVFGKWERPPLQLLEQALRKHNVAEPCSIKVLDKATVPIIKLTDQETEVK
UniProt IDQ5XG87
MW60kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesLAK1, POLK, POLS, TRF4, LAK-1, PAPD7, TRF41, TRF4-
Read more...
NoteFor research use only
NCBINP_008930