Cart summary

You have no items in your shopping cart.

TEFM Rabbit Polyclonal Antibody (FITC)

TEFM Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2088558

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2088558
CategoryAntibodies
DescriptionTEFM Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityCanine, Human, Porcine
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human TEFM
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW18kDa
UniProt IDQ96QE5
Protein SequenceSynthetic peptide located within the following region: RSSLYWALHNFCCRKKSTTPKKITPNVTFCDENAKEPENALDKLFSSEQQ
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesC17orf42
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.