You have no items in your shopping cart.
TEAD4 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human TEAD4 |
| Target | TEAD4 |
| Protein Sequence | Synthetic peptide located within the following region: MMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE |
| Molecular Weight | 48kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Tead4 Rabbit Polyclonal Antibody [orb574665]
WB
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
Human, Mouse
Rabbit
Polyclonal
Unconjugated
100 μlTEAD4 Rabbit Polyclonal Antibody [orb576600]
IHC, WB
Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μlTEAD4 Rabbit Polyclonal Antibody [orb574664]
IF, WB
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μlTEA domain transcription factor 4 Antibody [orb556564]
ICC, IHC-P, WB
Human
Rabbit
Polyclonal
Unconjugated
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

WB Suggested Anti-TEAD4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: 293T cell lysate. TEAD4 is supported by BioGPS gene expression data to be expressed in HEK293T.

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The canonical 48 kDa isoform contains this peptide sequence, as do 44 and 34 kDa isoforms.

Sample Tissue: Human Ovary Tumor, Antibody Dilution: 1 ug/ml.

Sample Type: 293T, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

Positive control (+): 293T Cell Lysate (2T), Negative control (-): Human Stomach Tumor (T-ST), Antibody concentration: 3 ug/ml.

Immunohistochemistry with Human Pancrease lysate tissue at an antibody concentration of 5.0 ug/ml using anti-TEAD4 antibody (orb576601).

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
Documents Download
Request a Document
Protocol Information
TEAD4 Rabbit Polyclonal Antibody (orb576601)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review











