TEAD1 Rabbit Polyclonal Antibody

SKU: orb577162

Description

TEAD1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of TEAD1. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the C terminal region of human TEAD1. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cancer Biology, Cell Biology, Epigenetics & Chromatin

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TEAD1
• Target: TEAD1
• Protein Sequence: Synthetic peptide located within the following region: YMMNSVLENFTILLVVTNRDTQETLLCMACVFEVSNSEHGAQHHIYRLVK
• Molecular Weight: 46kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

AA, REF1, TCF13, TEF-1, NTEF-1, TCF-13, TEAD-1

Quick Database Links

Gene Symbol

TEAD1

UniProt

P28347

RefSeq (Protein):NP_068780