Cart summary

You have no items in your shopping cart.

TCTN2 Rabbit Polyclonal Antibody (HRP)

TCTN2 Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2087759

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2087759
CategoryAntibodies
DescriptionTCTN2 Rabbit Polyclonal Antibody (HRP)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityEquine, Human, Mouse, Porcine, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human TCTN2
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ConjugationHRP
MW73kDa
UniProt IDQ96GX1
Protein SequenceSynthetic peptide located within the following region: VIPGAVLEVTVRWKRGLDWCSSNETDSFSESPCILQTLLVSASHNSSCSA
NCBINP_001137322
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Alternative namesMKS8, TECT2, JBTS24, C12orf38
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.