TCF20 Rabbit Polyclonal Antibody

• Catalog Number: orb324767
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TCF20
• Target: TCF20
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TCF20
• Protein Sequence: Synthetic peptide located within the following region: HYPCAIDADCLLHEENFSVRCPKHKPPLPCPLPPLQNKTAKGSLSTEQSE
• UniProt ID: Q9UGU0
• MW: 212kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti AR1 antibody, anti KIAA0292 antibody, anti SP
• Research Area: Cardiovascular Research, Epigenetics & Chromatin,
• Note: For research use only
• NCBI: NP_005641

Rabbit Anti-TCF20 Antibody, Catalog Number: orb324767, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Nuclear (nuclear membrane), Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 – 2.0 sec, Protocol located in Reviews and Data.

WB Suggested Anti-TCF20 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: OVCAR-3 cell lysate, TCF20 is supported by BioGPS gene expression data to be expressed in OVCAR3.