You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581502 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TBCB |
Target | TBCB |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human TBCB |
Protein Sequence | Synthetic peptide located within the following region: YDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI |
UniProt ID | Q99426 |
MW | 27kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | CG22, CKAP1, CKAPI |
Note | For research use only |
NCBI | NP_001272 |
TBCB antibody - C-terminal region (orb581502) validated by WB using cell line: HEK293T (Human embryonic kidney cells). TBCB is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.
WB Suggested Anti-TBCB Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Lung.
ELISA, IF, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |