You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb586459 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TBC1D3 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human TBC1D3 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 60kDa |
Target | TBC1D3 |
UniProt ID | Q8IZP1 |
Protein Sequence | Synthetic peptide located within the following region: NRFVDTWARDEDTVLKHLRASMKKLTRKQGDLPPPAKPEQGSSASRPVPA |
NCBI | NP_001116863 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | PRC17, TBC1D3A, TBC1D3C, TBC1D3D, TBC1D3F, TBC1D3L Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: Human 293T, Antibody dilution: 1.0 ug/ml. TBC1D3 is supported by BioGPS gene expression data to be expressed in HEK293T.
Sample Type: Human Jurkat, Antibody dilution: 1.0 ug/ml. TBC1D3 is supported by BioGPS gene expression data to be expressed in Jurkat.
WB Suggested Anti-TBC1D3 Antibody, Titration: 1.0 ug/ml, Positive Control: MCF7 Whole Cell.
ELISA, IF, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |