TBC1D2B Rabbit Polyclonal Antibody

• Catalog Number: orb324387
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TBC1D2B
• Target: TBC1D2B
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: EDALQVESQEQPEQAFVKPHLVSEYDIYGFRTVPEDDEEEKLVAKVRALD
• UniProt ID: Q9UPU7
• MW: 91kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti FLJ20166 antibody, anti KIAA1055 antibody
• Research Area: Cell Biology, Protein Biochemistry
• Note: For research use only
• NCBI: NP_055894
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-TBC1D2B Antibody, Titration: 1.0 ug/mL, Positive Control: PANC1 Whole Cell, TBC1D2B is strongly supported by BioGPS gene expression data to be expressed in Human PANC1 cells.