Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 1 - 2 weeks
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name TBC1D2B antibody
Catalog Number orb324387
Species/HostRabbit
ReactivityCanine, Equine, Guinea pig, Human, Mouse, Rat
ConjugationUnconjugated
Tested applicationsWB
Immunogen Synthetic peptide located within the following region: EDALQVESQEQPEQAFVKPHLVSEYDIYGFRTVPEDDEEEKLVAKVRALD
Target TBC1D2B
Alternative Names
Product Properties
Form/Appearance Liquid: supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Storage Store at 4°C for up to two weeks. For long term storage, aliquot and store at -20°C, avoid freeze/thaw cycles.
Note For research use only.
Isotype IgG
ClonalityPolyclonal
Purity Affinity Purified
MW 91 kDa
Uniprot ID Q9UPU7
NCBI NM_015079; NP_055894
Entrez 23102
Product Description

Rabbit polyclonal antibody to TBC1D2B

Validation Images
Western blot analysis of PANC1 Whole Cell tissue using TBC1D2B antibody
Western blot analysis of PANC1 Whole Cell tissue using TBC1D2B antibody
Reviews
Write Your Own Review
You're reviewing:TBC1D2B antibody - orb324387
Your Rating