Cart summary

You have no items in your shopping cart.

TBC1D10A Rabbit Polyclonal Antibody (FITC)

TBC1D10A Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2097174

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2097174
CategoryAntibodies
DescriptionTBC1D10A Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityGuinea pig, Human
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human TBC1D10A
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW57kDa
UniProt IDQ9BXI6
Protein SequenceSynthetic peptide located within the following region: GRGQLEKPPAPNQAMVVAAAGDACPPQHVPPKDSAPKDSAPQDLAPQVSA
NCBINP_114143
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesEPI64, TBC1D10, dJ130H16.1, dJ130H16.2
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.