You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb582661 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to TBC1D1 |
| Target | TBC1D1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TBC1D1 |
| Protein Sequence | Synthetic peptide located within the following region: RGSPGVSQRKLMRYHSVSTETPHERKDFESKANHLGDSGGTPVKTRRHSW |
| UniProt ID | Q86TI0 |
| MW | 133kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | TBC, TBC1 |
| Research Area | Epigenetics & Chromatin, Molecular Biology, Signal Read more... |
| Note | For research use only |
| NCBI | NP_055988 |

Sample Tissue: Human ACHN, Antibody dilution: 1.0 ug/ml.

Positive control (+): Human Testis Tumor (T-TE), Negative control (-): Human Lung Tumor (T-LU), Antibody concentration: 0.8 ug/ml.

Kidney

WB Suggested Anti-TBC1D1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 721_B cell lysate. TBC1D1 is supported by BioGPS gene expression data to be expressed in 721_B.

WB Suggested Anti-TBC1D1 antibody Titration: 1 ug/ml, Sample Type: Human heart.
IHC | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
HRP |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
FITC |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review