You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb582661 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TBC1D1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TBC1D1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 133kDa |
Target | TBC1D1 |
UniProt ID | Q86TI0 |
Protein Sequence | Synthetic peptide located within the following region: RGSPGVSQRKLMRYHSVSTETPHERKDFESKANHLGDSGGTPVKTRRHSW |
NCBI | NP_055988 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | TBC, TBC1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Human ACHN, Antibody dilution: 1.0 ug/ml.
Positive control (+): Human Testis Tumor (T-TE), Negative control (-): Human Lung Tumor (T-LU), Antibody concentration: 0.8 ug/ml.
Kidney
WB Suggested Anti-TBC1D1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 721_B cell lysate. TBC1D1 is supported by BioGPS gene expression data to be expressed in 721_B.
WB Suggested Anti-TBC1D1 antibody Titration: 1 ug/ml, Sample Type: Human heart.
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
HRP |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
FITC |