TBC1D1 Rabbit Polyclonal Antibody

• Catalog Number: orb582661
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TBC1D1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TBC1D1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 133kDa
• Target: TBC1D1
• UniProt ID: Q86TI0
• Protein Sequence: Synthetic peptide located within the following region: RGSPGVSQRKLMRYHSVSTETPHERKDFESKANHLGDSGGTPVKTRRHSW
• NCBI: NP_055988
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: TBC, TBC1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human ACHN, Antibody dilution: 1.0 ug/ml.

Positive control (+): Human Testis Tumor (T-TE), Negative control (-): Human Lung Tumor (T-LU), Antibody concentration: 0.8 ug/ml.

Kidney

WB Suggested Anti-TBC1D1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 721_B cell lysate. TBC1D1 is supported by BioGPS gene expression data to be expressed in 721_B.

WB Suggested Anti-TBC1D1 antibody Titration: 1 ug/ml, Sample Type: Human heart.