You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1140642 |
---|---|
Category | Proteins |
Description | Autophagy inducing peptide; Cell penetrating peptides. |
CAS Number | 1423821-88-8 |
Form/Appearance | Freeze dried solid |
Purity | > 95% by hplc |
MW | 3741.15 Da |
Formula | C164H251N57O45 |
H-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Thr-Asn-Val-Phe-Asn-Ala-Thr-Phe-Glu-Ile-Trp-His-Asp-Gly-Glu-Phe-Gly-Thr-OH | |
Solubility (25°C) | Soluble in water |
Protein Sequence | YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT |
Storage | Store dry, frozen and in the dark |
Alternative names | 1423821-88-8, Beclin-1 Activator ITat-BECN1, Tat-B Read more... |
Background | Tat-beclin 1 is a cell permeable peptide derived from the domain of the autophagy protein beclin 1 that interacts with HIV-1 Nef, attached to the HIV-1 Tat protein transduction domain. Tat-beclin 1 activates beclin1 by competing against its negative regulator GAPR-1/glioma pathogenesis-related protein-2 (GLIPR2). Tat-beclin 1 suppresses the accumulation of htt103Q, a polyglutamine expansion protein derived from human mutant Huntingtin protein, and can inhibit the replication of pathogens including HIV-1 and West Nile virus in vitro and in vivo. |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
98.00% | |
3855.12 | |
C166H252F3N57O47 |
Filter by Rating