Tat-beclin 1

• Catalog Number: orb1140642
• Category: Proteins
• Description: Autophagy inducing peptide; Cell penetrating peptides.
• CAS Number: 1423821-88-8
• Form/Appearance: Freeze dried solid
• Purity: > 95% by hplc
• MW: 3741.15 Da
• Formula: C₁₆₄H₂₅₁N₅₇O₄₅
• Structure: H-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Thr-Asn-Val-Phe-Asn-Ala-Thr-Phe-Glu-Ile-Trp-His-Asp-Gly-Glu-Phe-Gly-Thr-OH
• Solubility (25°C): Soluble in water
• Protein Sequence: YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT
• Storage: Store dry, frozen and in the dark
• Alternative names: 1423821-88-8, Beclin-1 Activator ITat-BECN1, Tat-B
• Background: Tat-beclin 1 is a cell permeable peptide derived from the domain of the autophagy protein beclin 1 that interacts with HIV-1 Nef, attached to the HIV-1 Tat protein transduction domain. Tat-beclin 1 activates beclin1 by competing against its negative regulator GAPR-1/glioma pathogenesis-related protein-2 (GLIPR2). Tat-beclin 1 suppresses the accumulation of htt103Q, a polyglutamine expansion protein derived from human mutant Huntingtin protein, and can inhibit the replication of pathogens including HIV-1 and West Nile virus in vitro and in vivo.
• Note: For research use only
• Expiration Date: 12 months from date of receipt.