You have no items in your shopping cart.
Tat-beclin 1
SKU: orb1140642
Description
Images & Validation
−
Key Properties
−| Molecular Weight | 3741.15 Da |
|---|---|
| Protein Sequence | H-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Thr-Asn-Val-Phe-Asn-Ala-Thr-Phe-Glu-Ile-Trp-His-Asp-Gly-Glu-Phe-Gly-Thr-OH |
| Purity | > 95% by hplc |
Storage & Handling
−| Storage | Store dry, frozen and in the dark |
|---|---|
| Form/Appearance | Freeze dried solid |
| Disclaimer | For research use only |
Alternative Names
−1423821-88-8, Beclin-1 Activator ITat-BECN1, Tat-Beclin 1, YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT, beclin 1 peptide
Similar Products
−
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Tat-beclin 1 (orb1140642)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days