Cart summary

You have no items in your shopping cart.

TARS2 Rabbit Polyclonal Antibody (FITC)

TARS2 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2094351

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2094351
CategoryAntibodies
DescriptionTARS2 Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityBovine, Canine, Human, Porcine, Rat, Yeast
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of human TARS2
Protein SequenceSynthetic peptide located within the following region: VVVIPVGSEQEEYAKEAQQSLRAAGLVSDLDADSGLTLSRRIRRAQLAHY
UniProt IDQ9BW92
MW48kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesthrRS, TARSL1, COXPD21
NoteFor research use only
NCBINP_001258825.1