TAPBP Rabbit Polyclonal Antibody

SKU: orb579463

Description

TAPBP Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of TAPBP. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the C terminal region of human TAPBP. This antibody reacts with Human samples and is predicted to react with Bovine, Porcine, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Porcine, Sheep

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TAPBP
• Target: TAPBP
• Protein Sequence: Synthetic peptide located within the following region: GEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLSALRHHS
• Molecular Weight: 46kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

TPN, TAPA, TPSN, NGS17

WB analysis of orb579463.

Human Skin

Rabbit Anti-TAPBP Antibody, Catalog Number: orb579463, Formalin Fixed Paraffin Embedded Tissue: Human Adult liver, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-TAPBP Antibody Titration: 0.5 ug/ml, Positive Control: HepG2 cell lysate.

WB Suggested Anti-TAPBP antibody Titration: 1 ug/ml, Sample Type: Human liver.

Quick Database Links

Gene Symbol

TAPBP

UniProt

O15533

RefSeq (Protein):NP_003181