TAPBP Rabbit Polyclonal Antibody

• Catalog Number: orb579463
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TAPBP
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Porcine, Sheep
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TAPBP
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 46kDa
• Target: TAPBP
• UniProt ID: O15533
• Protein Sequence: Synthetic peptide located within the following region: GEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLSALRHHS
• NCBI: NP_003181
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: TPN, TAPA, TPSN, NGS17
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Human Skin

Rabbit Anti-TAPBP Antibody, Catalog Number: orb579463, Formalin Fixed Paraffin Embedded Tissue: Human Adult liver, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-TAPBP Antibody Titration: 0.5 ug/ml, Positive Control: HepG2 cell lysate.

WB Suggested Anti-TAPBP antibody Titration: 1 ug/ml, Sample Type: Human liver.