You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb578893 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to TAP1 |
| Target | TAP1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TAP1 |
| Protein Sequence | Synthetic peptide located within the following region: LVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGL |
| UniProt ID | Q03518 |
| MW | 87 kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | APT1, PSF1, ABC17, ABCB2, PSF-1, RING4, TAP1N, D6S Read more... |
| Research Area | Cell Biology, Immunology & Inflammation, Molecular Read more... |
| Note | For research use only |
| NCBI | NP_000584 |

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 4 ug/ml of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/ml.

Sample Type: Hela, Antibody Dilution: 1.0 ug/ml. TAP1 is supported by BioGPS gene expression data to be expressed in HeLa.

Positive control (+): Human Ovary (OV), Negative control (-): HepG2 (HG), Antibody concentration: 4 ug/ml.

Rabbit Anti-TAP1 Antibody, Catalog Number: orb578893, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Cytoplasmic in alveolar type I & II cells, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-TAP1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: MCF7 cell lysate.
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC | |
Bovine, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, IP, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC | |
Bovine, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
BF405 |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review