TAF7 Rabbit Polyclonal Antibody

• Catalog Number: orb592959
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TAF7
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Guinea pig, Mouse, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TAF7
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 40kDa
• Target: TAF7
• UniProt ID: Q15545
• Protein Sequence: Synthetic peptide located within the following region: MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPD
• NCBI: NP_005633
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: TAF2F, TAFII55
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Human kidney

Human Lung

Rabbit Anti-TAF7 antibody, Paraffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-TAF7 Antibody Titration: 5.0-8.0 ug/ml, Positive Control: Jurkat cell lysate. TAF7 is supported by BioGPS gene expression data to be expressed in Jurkat.