You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576268 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TAF1B |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Guinea pig, Rat |
Reactivity | Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of mouse TAF1B |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 64kDa |
Target | TAF1B |
UniProt ID | P97358 |
Protein Sequence | Synthetic peptide located within the following region: YQFILNIFSFLLRIKTSALHEEVSLLEKKLFEKKYNESKKSSGSKKGRRH |
NCBI | NP_065639 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | p6, p63, mTAFI, TAFI68, Tafi86, 4930408G01Rik, A23 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Lanes: 30 ug NIH3T3 cell lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody Dilution: 1:5000, Gene Name: TAF1B.
WB Suggested Anti-TAF1B Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:312500, Positive Control: SP2/0 cell lysate.
IP, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |