TAF1B Rabbit Polyclonal Antibody

• Catalog Number: orb576268
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TAF1B
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Guinea pig, Rat
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse TAF1B
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 64kDa
• Target: TAF1B
• UniProt ID: P97358
• Protein Sequence: Synthetic peptide located within the following region: YQFILNIFSFLLRIKTSALHEEVSLLEKKLFEKKYNESKKSSGSKKGRRH
• NCBI: NP_065639
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: p6, p63, mTAFI, TAFI68, Tafi86, 4930408G01Rik, A23
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Lanes: 30 ug NIH3T3 cell lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody Dilution: 1:5000, Gene Name: TAF1B.

WB Suggested Anti-TAF1B Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:312500, Positive Control: SP2/0 cell lysate.