You have no items in your shopping cart.
TAF1B Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Mouse |
| Predicted Reactivity | Guinea pig, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of mouse TAF1B |
| Target | TAF1B |
| Protein Sequence | Synthetic peptide located within the following region: YQFILNIFSFLLRIKTSALHEEVSLLEKKLFEKKYNESKKSSGSKKGRRH |
| Molecular Weight | 64kDa |
| Purification | Protein A purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−TAF1B Rabbit Polyclonal Antibody [orb631706]
ELISA, IHC, WB
Human
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μgTAF1B Rabbit Polyclonal Antibody [orb1879837]
WB
Human
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 50 μl, 30 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Lanes: 30 ug NIH3T3 cell lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody Dilution: 1:5000, Gene Name: TAF1B.

WB Suggested Anti-TAF1B Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:312500, Positive Control: SP2/0 cell lysate.
Documents Download
Request a Document
TAF1B Rabbit Polyclonal Antibody (orb576268)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review



