TADA2L Rabbit Polyclonal Antibody

• Catalog Number: orb576503
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TADA2L
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TADA2L
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 36kDa
• Target: TADA2A
• UniProt ID: Q9BVJ0
• Protein Sequence: Synthetic peptide located within the following region: MDRLGPFSNDPSDKPPCRGCSSYLMEPYIKCAECGPPPFFLCLQCFTRGF
• NCBI: NP_597683
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ADA2, ADA2A, KL04P, hADA2, TADA2L
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: 721_B, Antibody Dilution: 1.0 ug/ml. TADA2A is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

WB Suggested Anti-TADA2L Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate. TADA2A is strongly supported by BioGPS gene expression data to be expressed in Jurkat.