Cart summary

You have no items in your shopping cart.

TADA1L Rabbit Polyclonal Antibody (Biotin)

TADA1L Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2109229

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2109229
CategoryAntibodies
DescriptionTADA1L Rabbit Polyclonal Antibody (Biotin)
ClonalityPolyclonal
Species/HostRabbit
ConjugationBiotin
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human TADA1L
Protein SequenceSynthetic peptide located within the following region: REVIPTHTVYALNIERIITKLWHPNHEELQQDKVHRQRLAAKEGLLLC
UniProt IDQ96BN2
MW37kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesADA1, HFI1, hADA1, STAF42, TADA1L
NoteFor research use only
NCBINP_444281