TADA1L Rabbit Polyclonal Antibody

• Catalog Number: orb325749
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TADA1
• Target: TADA1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TADA1L
• Protein Sequence: Synthetic peptide located within the following region: REVIPTHTVYALNIERIITKLWHPNHEELQQDKVHRQRLAAKEGLLLC
• UniProt ID: Q96BN2
• MW: 37kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti KIAA0764 antibody, anti RP1-9E21.4 antibody,
• Note: For research use only
• NCBI: NP_444281

WB Suggested Anti-TADA1L Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:2500, Positive Control: Hela cell lysate.