Cart summary

You have no items in your shopping cart.

TAC3 Rabbit Polyclonal Antibody (HRP)

TAC3 Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2122295

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2122295
CategoryAntibodies
DescriptionTAC3 Rabbit Polyclonal Antibody (HRP)
ClonalityPolyclonal
Species/HostRabbit
ConjugationHRP
Predicted ReactivityHuman
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human TAC3
Protein SequenceSynthetic peptide located within the following region: RSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDF
UniProt IDQ9UHF0
MW13kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesNK3, NKB, HH10, NKNB, PRO1155, ZNEUROK1, LncZBTB39
NoteFor research use only
NCBINP_037383
  • NKB Rabbit Polyclonal Antibody (HRP) [orb483166]

    IHC-Fr,  IHC-P

    Bovine, Human, Porcine

    Mouse, Rat

    Rabbit

    Polyclonal

    HRP

    100 μl