TAAR6 Rabbit Polyclonal Antibody

SKU: orb326537

Description

TAAR6 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of TAAR6. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the C-terminal region of Human TAAR6. This antibody reacts with Human, Monkey, Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Signal Transduction

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human, Monkey, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TAAR6
• Target: TAAR6
• Protein Sequence: Synthetic peptide located within the following region: YGNIFLVARRQAKKIENTGSKTESSSESYKARVARRERKAAKTLGVTVVA
• Molecular Weight: 38kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti RP11-295F4.3 antibody, anti TA4 antibody, anti TAR4 antibody, anti TAR6 antibody, anti TRAR4 antibody

Quick Database Links

Gene Symbol

TAAR6

UniProt

Q96RI8

RefSeq (Protein):NP_778237