You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb326537 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to TAAR6 |
| Target | TAAR6 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human, Monkey, Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human TAAR6 |
| Protein Sequence | Synthetic peptide located within the following region: YGNIFLVARRQAKKIENTGSKTESSSESYKARVARRERKAAKTLGVTVVA |
| UniProt ID | Q96RI8 |
| MW | 38kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti RP11-295F4.3 antibody, anti TA4 antibody, ant Read more... |
| Research Area | Cell Biology, Signal Transduction |
| Note | For research use only |
| NCBI | NP_778237 |

Application: IHC, Species+tissue/cell type: Ventral horn region of mouse spinal cord, Primary antibody Dilution: 1:200, Secondary antibody: Donkey anti-rabbit CY2, Secondary antibody Dilution: 1:500.

Application: IHC, Species+tissue/cell type: Rhesus macaque spinal cord, Primary antibody Dilution: 1:300, Secondary antibody: Donkey anti Rabbit 488, Secondary antibody Dilution: 1:500.

WB Suggested Anti-TAAR6 Antibody, Titration: 1.0 ug/mL, Positive Control: A549 Whole Cell.
WB | |
Bovine, Equine, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
FITC |
WB | |
Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Biotin |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review