TAAR6 Rabbit Polyclonal Antibody

• Catalog Number: orb326537
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TAAR6
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Monkey, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TAAR6
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 38kDa
• Target: TAAR6
• UniProt ID: Q96RI8
• Protein Sequence: Synthetic peptide located within the following region: YGNIFLVARRQAKKIENTGSKTESSSESYKARVARRERKAAKTLGVTVVA
• NCBI: NP_778237
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti RP11-295F4.3 antibody, anti TA4 antibody, ant
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Application: IHC, Species+tissue/cell type: Ventral horn region of mouse spinal cord, Primary antibody Dilution: 1:200, Secondary antibody: Donkey anti-rabbit CY2, Secondary antibody Dilution: 1:500.

Application: IHC, Species+tissue/cell type: Rhesus macaque spinal cord, Primary antibody Dilution: 1:300, Secondary antibody: Donkey anti Rabbit 488, Secondary antibody Dilution: 1:500.

WB Suggested Anti-TAAR6 Antibody, Titration: 1.0 ug/mL, Positive Control: A549 Whole Cell.