Cart summary

You have no items in your shopping cart.

SYT10 Rabbit Polyclonal Antibody (HRP)

SYT10 Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2088869

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2088869
CategoryAntibodies
DescriptionSYT10 Rabbit Polyclonal Antibody (HRP)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human SYT10
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ConjugationHRP
MW58kDa
UniProt IDQ6XYQ8
Protein SequenceSynthetic peptide located within the following region: RGETTTSIGRIKPELYKQKSVDSEGNQNEDVKICGKLNFTLQYDYENELL
NCBINP_945343
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
NoteFor research use only
Expiration Date12 months from date of receipt.
  • Synaptotagmin X Rabbit Polyclonal Antibody (HRP) [orb482402]

    ELISA,  IHC-Fr,  IHC-P,  WB

    Canine, Equine, Gallus, Human, Mouse, Porcine, Rabbit, Rat

    Rabbit

    Polyclonal

    HRP

    100 μl