SUR2A Antibody

• Catalog Number: orb99100
• Category: Antibodies
• Description: Mouse Anti-Mouse SUR2A Monoclonal IgG2A
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: S319A-14
• Tested applications: ICC, IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG2A
• Immunogen: Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A
• Concentration: 1 mg/ml
• Dilution range: WB (1:1000)
• Conjugation: Unconjugated
• MW: 120kDa
• Target: SUR2A
• Entrez: 20928
• UniProt ID: P70170
• NCBI: NP_001038185.1
• Storage: -20°C
• Buffer/Preservatives: PBS pH 7.4, 50% glycerol, 0.1% sodium azide *Storage buffer may change when conjugated
• Alternative names: ABCC9 Antibody, Sulfonylurea receptor 2 Antibody,
• Note: For research use only
• Application notes: 1 µg/ml of SMC-431 was sufficient for detection of SUR2A in 20 µg of mouse brain membrane lysate and assayed by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody.
• Expiration Date: 12 months from date of receipt.

Immunofluorescence analysis of neuroblastoma cell line sk-n-be using SUR2A antibody

Western Blot analysis of rat brain membrane using SUR2A antibody