You have no items in your shopping cart.
SUR2A Antibody
Description
Research Area
Images & Validation
−| Tested Applications | ICC, IF, IHC, WB |
|---|---|
| Dilution Range | WB (1:1000) |
| Reactivity | Human, Mouse, Rat |
| Application Notes |
Key Properties
−| Host | Mouse |
|---|---|
| Clonality | Monoclonal |
| Isotype | IgG2A |
| Clone No. | N319A/14 (Formerly sold as S319A-14) |
| Immunogen | Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A |
| Target | SUR2A |
| Molecular Weight | 120kDa |
| Purification | Protein G Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | PBS pH 7.4, 50% glycerol, 0.1% sodium azide Storage buffer changes when conjugated |
| Concentration | 1 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−ABCC9 Antibody [orb525139]
ELISA, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μlABCC9 Rabbit Polyclonal Antibody (Biotin) [orb452513]
WB
Canine, Equine, Human, Porcine, Sheep
Mouse, Rat
Rabbit
Polyclonal
Biotin
100 μlABCC9 Rabbit Polyclonal Antibody [orb317546]
WB
Canine, Equine, Human, Porcine, Sheep
Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Immunocytochemistry/Immunofluorescence analysis using Mouse Anti-SUR2A Monoclonal Antibody, Clone N319A/14. Tissue: Neuroblastoma cells (SH-SY5Y). Species: Human. Fixation: 4% PFA for 15 min. Primary Antibody: Mouse Anti-SUR2A Monoclonal Antibody at 1:200 for overnight at 4°C with slow rocking. Secondary Antibody: AlexaFluor 488 at 1:1000 for 1 hour at RT. Counterstain: Phalloidin-iFluor 647 (red) F-Actin stain; Hoechst (blue) nuclear stain at 1:800, 1.6mM for 20 min at RT. (A) Hoechst (blue) nuclear stain. (B) Phalloidin-iFluor 647 (red) F-Actin stain. (C) SUR2A Antibody (D) Composite.

Western Blot analysis of Rat Brain Membrane showing detection of ~120 kDa SUR2A protein using Mouse Anti-SUR2A Monoclonal Antibody, Clone N319A/14. Lane 1: MW Ladder. Lane 2: Rat Brain Membrane (10 μg). Load: 10 μg. Block: 5% milk. Primary Antibody: Mouse Anti-SUR2A Monoclonal Antibody at 1:1000 for 1 hour at RT. Secondary Antibody: Goat Anti-Mouse IgG: HRP at 1:200 for 1 hour at RT. Color Development: TMB solution for 10 min at RT. Predicted/Observed Size: ~120 kDa.
Quick Database Links
UniProt Details
−NCBI Gene Details
−NCBI Reference Sequences
−| Protein | NP_001038185.1 |
|---|
Documents Download
Request a Document
Protocol Information
SUR2A Antibody (orb99100)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review







