SUR2A Antibody

SKU: orb99100

Description

Mouse Anti-Mouse SUR2A Monoclonal IgG2A

Research Area

Cancer Biology, Cell Biology, Disease Biomarkers, Neuroscience, Signal Transduction

Images & Validation

• Tested Applications: ICC, IF, IHC, WB
• Dilution Range: WB (1:1000)
• Reactivity: Human, Mouse, Rat
• Application Notes:
  1 µg/ml was sufficient for detection of SUR2A in 20 µg of mouse brain membrane lysate and assayed by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody.

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2A
• Clone No.: N319A/14 (Formerly sold as S319A-14)
• Immunogen: Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A
• Target: SUR2A
• Molecular Weight: 120kDa
• Purification: Protein G Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: PBS pH 7.4, 50% glycerol, 0.1% sodium azide. Storage buffer changes when conjugated.
• Concentration: 1 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

ABCC9, Sulfonylurea receptor 2, CMD10, ABC37, ATP-binding cassette transporter sub-family C member 9, Sulfonylurea receptor 2A, isoform SUR2A

Quick Database Links

Gene Symbol

SUR2A

UniProt

P70170

NCBI Gene ID

20928

RefSeq (Protein):NP_001038185.1