Cart summary

You have no items in your shopping cart.

SUR2A Antibody (Biotin)

SKU: orb150354
FeaturedFeatured Product

Description

Mouse monoclonal to SUR2A (Biotin). Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins are subunits of the inward-rectifier potassium ion channels Kir6. x (6. 1 and 6. 2). The association of four K ir6. x and four SUR subunits form an ion conducting channel commonly referred to as the K ATP channel. The primary function of the sulfonylurea receptor is to sense intracellular levels of the nucleotides ATP and ADP and in response facilitate the open or closing its associated Kir 6. x potassium channel. Hence the K ATP channel monitors the energy balance within the cell..

Research Area

Cancer Biology, Cell Biology, Disease Biomarkers, Neuroscience, Signal Transduction

Images & Validation

Tested ApplicationsICC, IF, IHC, WB
Dilution RangeWB (1:1000)
ReactivityHuman, Mouse, Rat
Application Notes
1 µg/ml of SMC-431 was sufficient for detection of SUR2A in 20 µg of mouse brain membrane lysate and assayed by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody.

Key Properties

HostMouse
ClonalityMonoclonal
IsotypeIgG2A
Clone No.N319A/14 (Formerly sold as S319A-14)
ImmunogenFusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A
TargetSUR2A
Molecular Weight120kDa
PurificationProtein G Purified
ConjugationBiotin

Storage & Handling

StorageConjugated antibodies should be stored according to the product label
Buffer/Preservatives136.36mM Ethanolamine, 133.23 mM Chlorides, 9.55mM Phosphates, 9.55mM Sodium Bicarbonate
Concentration1 mg/ml
DisclaimerFor research use only

Alternative Names

ABCC9, Sulfonylurea receptor 2, CMD10, ABC37, ATP-binding cassette transporter sub-family C member 9, Sulfonylurea receptor 2A, isoform SUR2A

Similar Products

  • ABCC9 Rabbit Polyclonal Antibody (Biotin) [orb452513]

    WB

    Canine, Equine, Human, Porcine, Sheep

    Mouse, Rat

    Rabbit

    Polyclonal

    Biotin

    100 μl
  • ABCC9 Antibody (Biotin) [orb47826]

    ELISA

    Human

    Rabbit

    Polyclonal

    Biotin

    50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

SUR2A Antibody (Biotin)

Immunocytochemistry/Immunofluorescence analysis using Mouse Anti-SUR2A Monoclonal Antibody, Clone N319A/14. Tissue: Neuroblastoma cells (SH-SY5Y). Species: Human. Fixation: 4% PFA for 15 min. Primary Antibody: Mouse Anti-SUR2A Monoclonal Antibody at 1:200 for overnight at 4°C with slow rocking. Secondary Antibody: AlexaFluor 488 at 1:1000 for 1 hour at RT. Counterstain: Phalloidin-iFluor 647 (red) F-Actin stain; Hoechst (blue) nuclear stain at 1:800, 1.6mM for 20 min at RT. (A) Hoechst (blue) nuclear stain. (B) Phalloidin-iFluor 647 (red) F-Actin stain. (C) SUR2A Antibody (D) Composite.

SUR2A Antibody (Biotin)

Western Blot analysis of Rat Brain Membrane showing detection of ~120 kDa SUR2A protein using Mouse Anti-SUR2A Monoclonal Antibody, Clone N319A/14. Lane 1: MW Ladder. Lane 2: Rat Brain Membrane (10 μg). Load: 10 μg. Block: 5% milk. Primary Antibody: Mouse Anti-SUR2A Monoclonal Antibody at 1:1000 for 1 hour at RT. Secondary Antibody: Goat Anti-Mouse IgG: HRP at 1:200 for 1 hour at RT. Color Development: TMB solution for 10 min at RT. Predicted/Observed Size: ~120 kDa.

UniProt Details

No UniProt data available

NCBI Gene Details

No NCBI Gene data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol
IF
Immunofluorescence
View Protocol
ICC
Immunocytochemistry
View Protocol

SUR2A Antibody (Biotin) (orb150354)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μg
$ 650.00
DispatchUsually dispatched within 2-3 weeks
Bulk Enquiry