SUPT3H Rabbit Polyclonal Antibody

• Catalog Number: orb329562
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SUPT3H
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SUPT3H
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 36kDa
• Target: SUPT3H
• UniProt ID: O75486
• Protein Sequence: Synthetic peptide located within the following region: MRKDKKKLRRLLKYMFIRDYKSKIVKGIDEDDLLEDKLSGSNNANKRQKI
• NCBI: NP_003590
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti SPT3 antibody, anti SPT3L antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-SUPT3H Antibody, Paraffin Embedded Tissue: Human Liver, Cellular Data: Hepatocytes, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-SUPT3H Antibody Titration: 0.4 ug/mL, ELISA Titer: 1:1562500, Positive Control: HepG2 cell lysate, SUPT3H is supported by BioGPS gene expression data to be expressed in HepG2.