SUPT3H Rabbit Polyclonal Antibody

SKU: orb329562

Description

Rabbit polyclonal antibody to SUPT3H

Research Area

Cell Biology, Epigenetics & Chromatin, Molecular Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SUPT3H
• Target: SUPT3H
• Protein Sequence: Synthetic peptide located within the following region: MRKDKKKLRRLLKYMFIRDYKSKIVKGIDEDDLLEDKLSGSNNANKRQKI
• Molecular Weight: 36kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti SPT3 antibody, anti SPT3L antibody

Rabbit Anti-SUPT3H Antibody, Paraffin Embedded Tissue: Human Liver, Cellular Data: Hepatocytes, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-SUPT3H Antibody Titration: 0.4 ug/mL, ELISA Titer: 1:1562500, Positive Control: HepG2 cell lysate, SUPT3H is supported by BioGPS gene expression data to be expressed in HepG2.

Quick Database Links

Gene Symbol

SUPT3H

UniProt

O75486

RefSeq (Protein):NP_003590