Cart summary

You have no items in your shopping cart.

SUGP2 Rabbit Polyclonal Antibody (HRP)

SUGP2 Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2125889

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2125889
CategoryAntibodies
DescriptionSUGP2 Rabbit Polyclonal Antibody (HRP)
Species/HostRabbit
ClonalityPolyclonal
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the following sequence PGPSFRSSNPSISDDSYFRKECGRDLEFSHSDSRDQVIGHRKLGHFRSQD
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ConjugationHRP
MW120 kDa
UniProt IDQ8IX01
Protein SequenceSynthetic peptide located within the following region: PGPSFRSSNPSISDDSYFRKECGRDLEFSHSDSRDQVIGHRKLGHFRSQD
NCBINP_001017392
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Alternative namesSFRS14, SRFS14
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.