Cart summary

You have no items in your shopping cart.

Sugp1 Rabbit Polyclonal Antibody (FITC)

Sugp1 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2124606

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2124606
CategoryAntibodies
DescriptionSugp1 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW73kDa
UniProt IDQ8CH02
Protein SequenceSynthetic peptide located within the following region: NYSHAKQLPVAHRPSVFQSPDDDEEEDYEQWLEIKVSPPEGAETRRVIEK
NCBINP_081757
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesSf, Sf4, 5730496N02Rik
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.