You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb580641 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to STRADA |
| Target | STRADA |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human LYK5 |
| Protein Sequence | Synthetic peptide located within the following region: AEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFV |
| UniProt ID | Q7RTN6 |
| MW | 44kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | LYK5, PMSE, Stlk, STRAD, NY-BR-96, STRAD alpha |
| Research Area | Cell Biology, Epigenetics & Chromatin, Signal Tran Read more... |
| Note | For research use only |
| NCBI | NP_001003786 |

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. STRADA is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

WB Suggested Anti-LYK5 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate. STRADA is strongly supported by BioGPS gene expression data to be expressed in Jurkat.
FC, IF, IHC-P, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review