You have no items in your shopping cart.
STRA8 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Canine, Porcine |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Target | STRA8 |
| Protein Sequence | Synthetic peptide located within the following region: PEEKFQLYMQIINFFKGLSCANTQVKQEASFPVDEEMIMLQCTETFDDED |
| Molecular Weight | 37 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−Stra8 Rabbit Polyclonal Antibody [orb13700]
IF, IHC-Fr, IHC-P, WB
Human
Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlStra8 Rabbit Polyclonal Antibody [orb585823]
WB
Canine, Equine, Human, Porcine, Rat
Mouse
Rabbit
Polyclonal
Unconjugated
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment. Peptide is present in isoforms of 42 kDa, 37 kDa and 34 kDa. Protein may be phosphorylated.

Antibody dilution: 1.0 ug/ml, Sample Type: Human Lung.
Documents Download
Request a Document
STRA8 Rabbit Polyclonal Antibody (orb585824)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review






