STOM Rabbit Polyclonal Antibody

• Catalog Number: orb585015
• Category: Antibodies
• Description: Rabbit polyclonal antibody to STOM
• Target: STOM
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Protein Sequence: Synthetic peptide located within the following region: LQRAMAAEAEASREARAKVIAAEGEMNASRALKEASMVITESPAALQLRY
• UniProt ID: P27105
• MW: 32kDa
• Tested applications: IF, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: BND7, EPB7, EPB72
• Note: For research use only
• NCBI: NP_004090

Sample Type: HeLa cells, Primary Antibody dilution: 1:150, Secondary Antibody: Goat anti-rabbit-Alexa Fluor 488, Secondary Antibody dilution: 1:800, Color/Signal Descriptions: Green: STOM Blue: DAPI, Gene Name: STOM.

WB Suggested Anti-STOM Antibody, Titration: 1.0 ug/ml, Positive Control: Hela Whole Cell. STOM is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.