You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb580492 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to STK3 |
Target | STK3 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human STK3 |
Protein Sequence | Synthetic peptide located within the following region: IEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQ |
UniProt ID | Q13188 |
MW | 56kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | KRS1, MST2 |
Note | For research use only |
NCBI | NP_006272 |
Sample Tissue: Mouse Heart, Antibody dilution: 1 ug/ml.
Sample Tissue: Human Lung Tumor, Antibody dilution: 1.0 ug/ml.
Lanes: Lane 1: 100 ug uninduced RPE-1 lysate, Lane 2: 100 ug uninduced RPE-1 lysate, Lane 3: 100 ug STK3 induced RPE-1 lysate, Lane 4: 100 ug STK3 induced RPE-1 lysate, Primary Antibody dilution: 1:2000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:5000, Gene Name: STK3.
Lanes: Lane 1: 100 ug untransfected COS-7 lysate, Lane 2: 100 ug mock transfected Cos-7 lysate, Lane 3: 100 ug STK3 transfected Cos-7 lysate, Lane 4: 50 ug STK3 transfected Cos-7 lysate, Lane 5: 25 ug STK3 transfected Cos-7 lysate, Primary Antibody dilution: 1:2000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:5000, Gene Name: STK3.
Rabbit Anti-STK3 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-STK3 Antibody Titration: 5.0 ug/ml, Positive Control: HepG2 cell lysate.
IF, IHC-Fr, IHC-P, WB | |
Bovine, Equine, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, ICC, IF, IHC-Fr, IHC-P | |
Bovine, Equine, Gallus, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Zebrafish | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IHC-P, WB | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |