You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330564 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Stk25 |
Target | Stk25 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Rat |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Mouse |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide corresponding to a region of Rat |
Protein Sequence | Synthetic peptide located within the following region: TKKTSFLTELIDRYKRWKSEGHGEESSSEDSDIDGEAEDGEQGPIWTFPP |
UniProt ID | Q6V9V9 |
MW | 48kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti MGC94619 antibody, anti Stk25 antibody |
Note | For research use only |
NCBI | NP_908938 |
WB Suggested Anti-Stk25 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Rat Heart.
IF, IHC-Fr, IHC-P, WB | |
Bovine, Equine, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, ICC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Equine, Human, Mouse, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-Fr, IHC-P | |
Bovine, Equine, Porcine, Rat, Sheep | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |