You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb588439 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to STIL |
Target | STIL |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Human |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human STIL |
Protein Sequence | Synthetic peptide located within the following region: QKLSSGKMPIHDHDSGVEDEDFSPRPIPSPHPVSQKISKIQPSVPELSLV |
UniProt ID | Q15468 |
MW | 141 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | SIL, MCPH7 |
Note | For research use only |
WB Suggested Anti-STIL antibody Titration: 1 ug/ml, Sample Type: Human THP-1 Whole Cell.
ELISA, IF, IHC-Fr, IHC-P | |
Bovine, Human, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Bovine, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Cy5 |