STAT6 Rabbit Polyclonal Antibody

• Catalog Number: orb573717
• Category: Antibodies
• Description: Rabbit polyclonal antibody to STAT6
• Target: STAT6
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human STAT6
• Protein Sequence: Synthetic peptide located within the following region: NLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPELQM
• UniProt ID: P42226
• MW: 94kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: STAT6B, STAT6C, D12S1644, IL-4-STAT
• Note: For research use only
• NCBI: NP_003144

Human Testis

Human Tonsil

Human Prostate

Human kidney

STAT6 antibody - C-terminal region (orb573717), Catalog Number: orb573717, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Cytoplasm of pneumocytes, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-STAT6 Antibody Titration: 1 ug/ml, Positive Control: Hela cell lysate, STAT6 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.