You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb573717 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to STAT6 |
Target | STAT6 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human STAT6 |
Protein Sequence | Synthetic peptide located within the following region: NLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPELQM |
UniProt ID | P42226 |
MW | 94kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | STAT6B, STAT6C, D12S1644, IL-4-STAT |
Note | For research use only |
NCBI | NP_003144 |
Human Testis
Human Tonsil
Human Prostate
Human kidney
STAT6 antibody - C-terminal region (orb573717), Catalog Number: orb573717, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Cytoplasm of pneumocytes, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-STAT6 Antibody Titration: 1 ug/ml, Positive Control: Hela cell lysate, STAT6 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Sheep, Zebrafish | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Canine | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse, Porcine, Primate, Rabbit | |
Rabbit | |
Polyclonal | |
Unconjugated |