You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb573717 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to STAT6 |
| Target | STAT6 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human STAT6 |
| Protein Sequence | Synthetic peptide located within the following region: NLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPELQM |
| UniProt ID | P42226 |
| MW | 94kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | STAT6B, STAT6C, D12S1644, IL-4-STAT |
| Research Area | Cell Biology, Epigenetics & Chromatin, Immunology Read more... |
| Note | For research use only |
| NCBI | NP_003144 |

Human Testis

Human Tonsil

Human Prostate

Human kidney

STAT6 antibody - C-terminal region (orb573717), Catalog Number: orb573717, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Cytoplasm of pneumocytes, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-STAT6 Antibody Titration: 1 ug/ml, Positive Control: Hela cell lysate, STAT6 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Sheep, Zebrafish | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Canine | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC-P, IP, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
ELISA, IHC-P, WB | |
Human, Monkey, Mouse, Rat | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review