You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb584407 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to STARD8 |
Target | STARD8 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Human |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human STARD8 |
Protein Sequence | Synthetic peptide located within the following region: KKRHRNRSFLKHLESLRRKEKSGSQQAEPKHSPATSEKVSKASSFRSCRG |
UniProt ID | Q92502 |
MW | 122kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | DLC3, ARHGAP38, STARTGAP3 |
Research Area | Cell Biology, Signal Transduction |
Note | For research use only |
NCBI | NP_001135975 |
Expiration Date | 12 months from date of receipt. |
Lanes: Lane 1: 30 ug STARD8 transfected HEK293T lysate, Lane 2: 30 ug HEK293T lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP Anti-rabbit-HRP, Secondary Antibody dilution: 1:10000, Gene Name: STARD8.
WB Suggested Anti-STARD8 Antibody, Titration: 1.0 ug/ml, Positive Control: 293T Whole Cell.
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Gallus, Mouse, Porcine, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |