Cart summary

You have no items in your shopping cart.

STAMBPL1 Rabbit Polyclonal Antibody (FITC)

STAMBPL1 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2083878

Select Product Size
SizePriceQuantity
100 μl$ 0.00
100 μl Enquire
DispatchUsually dispatched within 5-10 working days
Product Properties
Catalog Numberorb2083878
CategoryAntibodies
DescriptionSTAMBPL1 Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityEquine, Guinea pig, Human, Porcine, Rabbit, Rat
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
PurificationAffinity Purified
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human STAMBPL1
Protein SequenceSynthetic peptide located within the following region: VFADQPNKSDATNYASHSPPVNRALTPAATLSAVQNLVVEGLRCVVLPED
UniProt IDQ96FJ0
MW47kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesAMSH-FP, AMSH-LP, ALMalpha, bA399O19.2
NoteFor research use only
Images
Similar Products
  • STAMBPL1 Rabbit Polyclonal Antibody (FITC) [orb2101614]

    WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

    Rabbit

    Polyclonal

    FITC

    100 μl
Reviews

STAMBPL1 Rabbit Polyclonal Antibody (FITC) (orb2083878)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet