STAMBPL1 Rabbit Polyclonal Antibody

SKU: orb588006

Description

Rabbit polyclonal antibody to STAMBPL1

Research Area

Cell Biology, Protein Biochemistry, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Equine, Guinea pig, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human STAMBPL1
• Target: STAMBPL1
• Protein Sequence: Synthetic peptide located within the following region: VFADQPNKSDATNYASHSPPVNRALTPAATLSAVQNLVVEGLRCVVLPED
• Molecular Weight: 47kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

AMSH-FP, AMSH-LP, ALMalpha, bA399O19.2

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/ml.

WB Suggested Anti-STAMBPL1 antibody Titration: 1 ug/ml, Sample Type: Human K562.

WB Suggested Anti-STAMBPL1 antibody Titration: 1 ug/ml, Sample Type: Human MDA-MB-435s.

Quick Database Links

Gene Symbol

STAMBPL1

UniProt

Q96FJ0