STAMBPL1 Rabbit Polyclonal Antibody

• Catalog Number: orb588006
• Category: Antibodies
• Description: Rabbit polyclonal antibody to STAMBPL1
• Target: STAMBPL1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Equine, Guinea pig, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human STAMBPL1
• Protein Sequence: Synthetic peptide located within the following region: VFADQPNKSDATNYASHSPPVNRALTPAATLSAVQNLVVEGLRCVVLPED
• UniProt ID: Q96FJ0
• MW: 47kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: AMSH-FP, AMSH-LP, ALMalpha, bA399O19.2
• Research Area: Cell Biology, Protein Biochemistry, Stem Cell & De
• Note: For research use only

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/ml.

WB Suggested Anti-STAMBPL1 antibody Titration: 1 ug/ml, Sample Type: Human K562.

WB Suggested Anti-STAMBPL1 antibody Titration: 1 ug/ml, Sample Type: Human MDA-MB-435s.